Related Searches
Recent Searches
- 54 wall mount paper
- inventor helmut
- dna56529 1647 203293
- display driving method
- detecting malicious code
- arm movement derived from
- batteries us pat no
- florida foundation seed producers
- 10 548934
- direct to plate flexographic printing
- james w brooks
- improving operation
- 6 1992 dimarco
- antenna radiotelephone
- 0051719 al
Popular Searches
- bombardier rotax gmbh
- billboard advertising
- billboard advertising system
- multimedia advertising billboard
- advertising billboard
- mobile billboard advertising system
- mobile multi message billboard advertising
- multi message billboard advertising system
- brown midrib
- using domain
- linux
- billboard advertising copy hoist
- mobile billboard system
- g fl peg
- mobile billboard advertising
Methods For inhibiting angiogenesis, cell migration, cell adhesion, and cell ...
Filed: June 25th, 2003 [Pending]
Patent Application Number: 10518181
The effect of migration buffer, 25 |xg/ml anti- av|33, 1 uM PTHrP 1-141, ... herein also shows one embodiment where PTHrP amino acids 1-10 are sufficient to ...
Form identification and processing system using hierarchical form profiles ...
Filed: April 4th, 1997 [Granted]
Assignee: Canon Information Systems Inc
Patent Number: 5721940
nontext index = 1 x=23 y=19 1=622 w=39 att = 40 1 .1 index = 1 x=31 y=33 1 =22 ... w=96 att = 1 X=324 y=34 1 =16 w=96 att = 1 1.3 index = 3x=148y=66 1=10 ...
Controlled release of herbicide compounds utilizing a thermoplastic matrix
Filed: July 24th, 1980 [Granted]
Assignee: Environmental Chemicals Inc
Patent Number: 4405360
1 M 33 60 65 75 — — 3D 10 M 57 85 ... (accumulative %) By Day CODE (ppm) PLANT 4 10 15 20 25 30 3J 10 C 10 60 87 93 100 — 33 1 M 33 50 80 97 100 — 3J 10 M ...
PROBER UNIT
Filed: February 25th, 2010 [Pending]
Patent Application Number: 12712734
The wiring boards 3 include lands 33-1 to 33-4 for the output terminals to be brought into contact with the probes 10-1 to 10-4. The probe assembly 1 ...
Surface-treated steel sheet with excellent corrosion resistance and method ...
Filed: October 26th, 2007 [Granted]
Patent Number: 8012599
... fication No *1 *2 *7 *3 *7 *4 *7 *5 *7 *6 *7 (nm) (° C.) Com- 32 1 1 100 1 25 1 40 1 5 1 10 1.5 140 parative example Com- 33 1 1 100 1 25 1 40 1 5 1 10 ...
Redundant operation of ring voltage generators utilizing voltage bus ...
Filed: April 12th, 2000 [Granted]
Assignee: Adtran Inc
Patent Number: 6813353
10 In the third embodiment, with relay contact 41-1 ... by the failure detector and relay control circuit 33-2 of the second ringing generator :5 20-2.
Neisserial antigens
Filed: June 8th, 2004 [Pending]
Patent Application Number: 10864684
... ORF33-1 show 94.1% identity in 444 aa overlap: 10 20 30 40 50 60 or f 3 3a . pep MLNPSRKLVELVRILEEGGFIFSGDPVQATEALRRVDGSTEEKIIRRAKMIDRNRMLRET or f 33-1 ...
Plasma or serum fraction for treatment and prevention of viral infections ...
Filed: August 22nd, 2005 [Pending]
Patent Application Number: 11209571
One hundred fifty microliters (150 |xL) of the serum product (designated VR-30) ... TV (IgM) -1:30 >1:10 — TV (IgG + IgM) -1:20 >1:10 — TV (PBS) -1:33 >1:10 ...
